-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2010-2146 of human ABCA7 (NP_061985.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ABCA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2010-2146 of human ABCA7 (NP_061985.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10504A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCA7 |
| Target Synonyms | AD9; ABCX; ABCA-SSN; ABCA7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2010-2146 of human ABCA7 (NP_061985.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QHLKGRFAAGHTLTLRVPAARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL | Uniprot ID | Q8IZY2 |
Uniprot Id
Q8IZY2
Target Species
Human
Target Name
ABCA7
Target Full Name
Phospholipid-transporting ATPase ABCA7
Target Function
Catalyzes the translocation of specific phospholipids from the cytoplasmic to the extracellular/lumenal leaflet of membrane coupled to the hydrolysis of ATP. Transports preferentially phosphatidylserine over phosphatidylcholine. Plays a role in lipid homeostasis and macrophage-mediated phagocytosis. Binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. May also mediate cholesterol efflux. May regulate cellular ceramide homeostasis during keratinocyte differentiation. Involved in lipid raft organization and CD1D localization on thymocytes and antigen-presenting cells, which plays an important role in natural killer T-cell development and activation. Plays a role in phagocytosis of apoptotic cells by macrophages. Macrophage phagocytosis is stimulated by APOA1 or APOA2, probably by stabilization of ABCA7. Also involved in phagocytic clearance of amyloid-beta by microglia cells and macrophages. Further limits amyloid-beta production by playing a role in the regulation of amyloid-beta A4 precursor protein (APP) endocytosis and/or processing. Amyloid-beta is the main component of amyloid plaques found in the brains of Alzheimer patients
Target Involvement
Alzheimer disease 9 (AD9)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Cytoplasm. Cell projection, ruffle membrane. Cell projection, phagocytic cup.; [Isoform 2]: Cytoplasm. Endoplasmic reticulum.
Target Protein Families
ABC transporter superfamily, ABCA family
Target Tissue Specificity
Expressed in leukocytes (at protein level). Widely expressed. Highly expressed in myelo-lymphatic tissues including peripheral leukocytes, thymus, spleen and bone marrow. Expressed in the hippocampus and the cerebellum. Isoform 2: Abundant in lymph node,
Target Synonyms
ABC transporter ABCA7; ABC transporter member 7; ABCA SSN; ABCA-SSN; ABCA7; ABCA7_HUMAN; ABCX; ATP binding cassette sub family A (ABC1) member 7; ATP binding cassette sub family A member 7; ATP binding Cassette Transporter A7; ATP-binding cassette sub-family A member 7; autoantigen SS N; Autoantigen SS-N; FLJ40025; Macrophage ABC transporter
Notification