-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 830-940 of human ABCC6 (NP_001162.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABCC6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 830-940 of human ABCC6 (NP_001162.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01782A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCC6 |
| Target Synonyms | ARA; PXE; MLP1; MRP6; PXE1; URG7; ABC34; GACI2; MOATE; MOAT-E; EST349056; ABCC6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 830-940 of human ABCC6 (NP_001162.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AIAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRVKATVHLAYLR | Uniprot ID | O95255 |
Uniprot Id
O95255
Target Species
Human
Target Name
ABCC6
Target Full Name
ATP-binding cassette sub-family C member 6
Target Function
ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes physiological compounds, and xenobiotics from cells. Mediates ATP-dependent transport of glutathione conjugates such as leukotriene-c4 (LTC4) and N-ethylmaleimide S-glutathione (NEM-GS) (in vitro), and an anionic cyclopentapeptide endothelin antagonist, BQ-123. Does not appear to actively transport drugs outside the cell. Confers low levels of cellular resistance to etoposide, teniposide, anthracyclines and cisplatin.; Mediates the release of nucleoside triphosphates, predominantly ATP, into the circulation, where it is rapidly converted into AMP and the mineralization inhibitor inorganic pyrophosphate (PPi) by the ecto-enzyme ectonucleotide pyrophosphatase phosphodiesterase 1 (ENPP1), therefore playing a role in PPi homeostasis.; Inhibits TNF-alpha-mediated apoptosis through blocking one or more caspases.
Target Involvement
Pseudoxanthoma elasticum (PXE); Arterial calcification of infancy, generalized, 2 (GACI2)
Target Subcellular Location
[Isoform 1]: Basolateral cell membrane; Multi-pass membrane protein.; [Isoform 2]: Endoplasmic reticulum membrane; Single-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCC family, Conjugate transporter (TC 3.A.1.208) subfamily
Target Tissue Specificity
Expressed in kidney and liver. Very low expression in other tissues.
Target Synonyms
ABC34; Abcc6; Anthracycline resistance-associated protein; ARA; ATP binding cassette sub family C (CFTR/MRP) member 6; ATP binding cassette sub family C member 6; ATP-binding cassette sub-family C member 6; EST349056; GACI2; MLP1; MOAT E; MOAT-E; MOATE; MRP 6; MRP6; MRP6_HUMAN; Multi-specific organic anion transporter E; Multidrug resistance associated protein 6; Multidrug resistance-associated protein 6; Multidrug resistance-associated protein 6, URG7 protein; multispecific organic anion transporter E; PXE; PXE1; URG7; URG7 protein
Target Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene.
Notification