-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 746-845 of human ABCF1 (Q8NE71) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ABCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 746-845 of human ABCF1 (Q8NE71) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14234A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABCF1 |
| Target Synonyms | ABC27; ABC50; ABCF1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 746-845 of human ABCF1 (Q8NE71). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQKARVVFAELACREPDVLILDEPTNNLDIESIDALGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRPRE | Uniprot ID | Q8NE71 |
Uniprot Id
Q8NE71
Target Species
Human
Target Name
ABCF1
Target Full Name
ATP-binding cassette sub-family F member 1
Target Function
Isoform 2 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Isoform 2 is not involved in the ribosome biogenesis.
Target Subcellular Location
[Isoform 2]: Cytoplasm. Nucleus, nucleoplasm. Nucleus envelope.
Target Protein Families
ABC transporter superfamily, ABCF family, EF3 subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ABC27; ABC50; ABCF1; ABCF1_HUMAN; ATP binding cassette 50 (TNF alpha stimulated); ATP binding cassette 50; ATP binding cassette sub family F member 1; ATP binding cassette; sub family F (GCN20); member 1; ATP-binding cassette 50; ATP-binding cassette sub-family F member 1; AU041969; D17Wsu166e; EST123147; GCN20; TNF alpha stimulated ABC protein; TNF-alpha-stimulated ABC protein; TNFalpha inducible ATP binding protein; wu:fb79c06; wu:fc39a05; wu:fj94a08; zgc:85667
Target Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process.
Notification