Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ABLIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-520 of human ABLIM3 (NP_001287957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ABLIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-520 of human ABLIM3 (NP_001287957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06991A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ABLIM3 |
| Target Synonyms | HMFN1661; ABLIM3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-520 of human ABLIM3 (NP_001287957.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTR | Uniprot ID | O94929 |
Uniprot Id
O94929
Target Species
Human
Target Name
ABLIM3
Target Full Name
Actin-binding LIM protein 3
Target Function
May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed predominantly in heart and brain.
Target Synonyms
abLIM-3; Ablim3; ABLM3_HUMAN; Actin binding LIM protein 3; Actin binding LIM protein family member 3; Actin-binding LIM protein 3; Actin-binding LIM protein family member 3; HMFN1661; KIAA0843
Target Background
This gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
