-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACVR1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ACVR1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10418A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACVR1C |
| Target Synonyms | ALK7; ACVRLK7; ACVR1C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BxPC-3, HT-29, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPME | Uniprot ID | Q8NER5 |
Uniprot Id
Q8NER5
Target Species
Human
Target Name
ACVR1C
Target Full Name
Activin receptor type-1C
Target Function
Serine/threonine protein kinase which forms a receptor complex on ligand binding. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3. Receptor for activin AB, activin B and NODAL. Plays a role in cell differentiation, growth arrest and apoptosis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Target Tissue Specificity
Present in pancreas, heart, colon, small intestine, ovary and the hippocampus, medulla oblongata and putamen of the brain. Isoform 1, isoform 2, isoform 3 and isoform 4 are all expressed in the placenta throughout pregnancy.
Target Synonyms
Activin A receptor; type IC; Activin receptor like kinase 7; Activin receptor type 1C precursor; Activin receptor type IC; Activin receptor type-1C; Activin receptor-like kinase 7; ACTR IC; ACTR-IC; ACTRIC; ACV1C_HUMAN; Acvr1c; ACVRLK7; ALK 7; ALK-7; ALK7
Target Background
ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).
Notification