Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADARB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-739 of human ADARB2 (NP_061172.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADARB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-739 of human ADARB2 (NP_061172.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10618A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADARB2 |
| Target Synonyms | RED2; ADAR3; ADARB2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-739 of human ADARB2 (NP_061172.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SHRMEGVGQLPASYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCGGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKAGLGTWVRKPPEQQQFLLTL | Uniprot ID | Q9NS39 |
Uniprot Id
Q9NS39
Target Species
Human
Target Name
ADARB2
Target Full Name
Double-stranded RNA-specific editase B2
Target Function
Lacks editing activity. It prevents the binding of other ADAR enzymes to targets in vitro, and decreases the efficiency of these enzymes. Capable of binding to dsRNA but also to ssRNA.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Brain specific. Expressed at higher levels in astrocytomas as compared to the normal brain tissue.
Target Synonyms
ADARB2; ADAR3; RED2; Double-stranded RNA-specific editase B2; EC 3.5.-.-; RNA-dependent adenosine deaminase 3; RNA-editing deaminase 2; RNA-editing enzyme 2; dsRNA adenosine deaminase B2
Target Background
This gene encodes a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
