-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AGTR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human AGTR2 (NP_000677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AGTR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human AGTR2 (NP_000677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07946A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AGTR2 |
| Target Synonyms | AT2; ATGR2; MRX88; AGTR2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human AGTR2 (NP_000677.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRIT | Uniprot ID | P50052 |
Uniprot Id
P50052
Target Species
Human
Target Name
AGTR2
Target Full Name
Type-2 angiotensin II receptor
Target Function
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine.
Target Research Area
Cardiovascular
Target Synonyms
AGTR 2; Agtr2; AGTR2_HUMAN; angiotensin II receptor type 2; Angiotensin II type-2 receptor; Angiotensin receptor 2; AT 2; AT2; ATGR 2; ATGR2; MRX 88; MRX88; Type 2 angiotensin II receptor; Type-2 angiotensin II receptor
Target Background
The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus and in neonates, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked cognitive disability. Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) and SARS-CoV-2 infection results in down-regulation of angiotensin converting enzyme-2 (ACE2) receptors, the effects of which, triggers serious inflammatory lesions in the tissues involved, primarily in the lungs. The inflammatory reaction appears to be mediated by angiotensin II derivatives, including the angiotensin AT2 receptor which has been found to be upregulated in bronchoalveolar lavage samples from Coronavirus disease 2019 (COVID19) patients.
Notification