Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDOC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ALDOC (NP_005156.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ALDOC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ALDOC (NP_005156.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDOC |
| Target Synonyms | ALDC; ALDOC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, LO2, Mouse brain, Rat spinal cord, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ALDOC (NP_005156.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANV | Uniprot ID | P09972 |
Uniprot Id
P09972
Target Species
Human
Target Name
ALDOC
Target Full Name
Fructose-bisphosphate aldolase C
Target Research Area
Cancer
Target Synonyms
ALDC; ALDO C; aldoc; ALDOC_HUMAN; Aldolase 3; Aldolase C Fructose bisphosphate; Brain type aldolase; Brain-type aldolase; Fructoaldolase C; Fructose 1 6 biphosphate triosephosphate lyase; Fructose bisphosphate aldolase C; Fructose-bisphosphate aldolase C
Target Background
This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1, 6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
