Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANKRD26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-440 of human ANKRD26 (NP_055730.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ANKRD26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-440 of human ANKRD26 (NP_055730.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07294A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANKRD26 |
| Target Synonyms | THC2; bA145E8.1; ANKRD26 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-440 of human ANKRD26 (NP_055730.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VESLPTTSIKVQCFSHPTYQSPDLLPKPSHKSLANPGLMKEEPTKPGIAKKENGIDIIESAPLEQTNNDNLTYVDEVHKNNRSDMMSALGLGQEEDIESPWDSESISENFPQKYVDPLAGA | Uniprot ID | Q9UPS8 |
Uniprot Id
Q9UPS8
Target Species
Human
Target Name
ANKRD26
Target Full Name
Ankyrin repeat domain-containing protein 26
Target Function
Acts as a regulator of adipogenesis. Involved in the regulation of the feeding behavior.
Target Involvement
Thrombocytopenia 2 (THC2)
Target Synonyms
Ankrd26; Ankyrin repeat domain 26; Ankyrin repeat domain-containing protein 26; Ankyrin repeat domaincontaining protein 26; ANR26_HUMAN; bA145E8.1; KIAA1074
Target Background
This gene encodes a protein containing N-terminal ankyrin repeats which function in protein-protein interactions. Mutations in this gene are associated with autosomal dominant thrombocytopenia-2. Pseudogenes of this gene are found on chromosome 7, 10, 13 and 16. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
