-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP3D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human AP3D1 (NP_003929.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AP3D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human AP3D1 (NP_003929.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03402A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP3D1 |
| Target Synonyms | ADTD; HPS10; hBLVR; AP3D1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, LO2, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human AP3D1 (NP_003929.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVE | Uniprot ID | O14617 |
Uniprot Id
O14617
Target Species
Human
Target Name
AP3D1
Target Full Name
AP-3 complex subunit delta-1
Target Function
Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. Involved in process of CD8+ T-cell and NK cell degranulation. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals.
Target Involvement
Hermansky-Pudlak syndrome 10 (HPS10)
Target Subcellular Location
Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Adaptor complexes large subunit family
Target Tissue Specificity
Present in all adult tissues examined with the highest levels in skeletal muscle, heart, pancreas and testis.
Target Synonyms
Adapter-related protein complex 3 subunit delta-1; adaptor-related protein complex 3, delta 1 subunit; ADTD; AP 3 complex delta subunit; AP-3 complex subunit delta; AP-3 complex subunit delta-1; ap3d1; AP3D1_HUMAN; Delta 1 subunit of adaptor-related protein complex 3; Delta Adaptin; Delta-adaptin; hBLVR; Subunit of putative vesicle coat adaptor complex AP 3
Target Background
The protein encoded by this gene is a subunit of the AP3 adaptor-like complex, which is not clathrin-associated, but is associated with the golgi region, as well as more peripheral structures. The AP-3 complex facilitates the budding of vesicles from the golgi membrane, and may be directly involved in trafficking to lysosomes. This subunit is implicated in intracellular biogenesis and trafficking of pigment granules, and possibly platelet dense granules and neurotransmitter vesicles. Defects in this gene are a cause of a new type of Hermansky-Pudlak syndrome.
Notification