-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APBA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human APBA1 (NP_001154.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against APBA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human APBA1 (NP_001154.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07328A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APBA1 |
| Target Synonyms | X11; X11A; LIN10; MINT1; D9S411E; X11ALPHA; APBA1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-390 of human APBA1 (NP_001154.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDLERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRD | Uniprot ID | Q02410 |
Uniprot Id
Q02410
Target Species
Human
Target Name
APBA1
Target Full Name
Amyloid-beta A4 precursor protein-binding family A member 1
Target Function
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the amyloid-beta precursor protein (APP) and hence formation of APP-beta. Component of the LIN-10-LIN-2-LIN-7 complex, which associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules.
Target Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Nucleus. Note=Only about 5% of the protein is located in the nucleus.; [Isoform 2]: Golgi apparatus.
Target Tissue Specificity
Brain and spinal cord. Isoform 2 is expressed in testis and brain, but not detected in lung, liver or spleen.
Target Synonyms
X11; X11A; LIN10; MINT1; D9S411E; X11ALPHA; APBA1
Target Background
The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion.
Notification