-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOBEC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against APOBEC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03610A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOBEC1 |
| Target Synonyms | APO1; BEDP; HEPR; CDAR1; APOBEC-1; APOBEC1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human APOBEC1 (NP_001291495). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSM | Uniprot ID | P41238 |
Uniprot Id
P41238
Target Species
Human
Target Name
APOBEC1
Target Full Name
C->U-editing enzyme APOBEC-1
Target Function
Catalytic component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in the APOB mRNA. Also involved in CGA (Arg) to UGA (Stop) editing in the NF1 mRNA. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Cytidine and deoxycytidylate deaminase family
Target Tissue Specificity
Expressed exclusively in the small intestine.
Target Synonyms
ABEC1_HUMAN; APOBEC 1; APOBEC1; Apolipoprotein B mRNA editing enzyme; Apolipoprotein B mRNA editing enzyme catalytic polypeptide 1; Apolipoprotein B mRNA editing enzyme complex 1; Apolipoprotein B mRNA-editing enzyme 1; BEDP; C->U-editing enzyme APOBEC-1; CDAR1; EC 3.5.4.; HEPR
Target Background
This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification