-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AR-V7 was raised in Rabbit using the synthetic peptide corresponding to a sequence within amino acids 544-644 of human AR-V7 (NP_001334990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AR-V7 was raised in Rabbit using the synthetic peptide corresponding to a sequence within amino acids 544-644 of human AR-V7 (NP_001334990.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AR-V7 |
| Target Synonyms | KD; AIS; AR8; TFM; DHTR; SBMA; HYSP1; NR3C4; SMAX1; HUMARA; AR-V7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, PC-3 | Application | ELISA, WB |
| Immunogen Description | synthetic peptide corresponding to a sequence within amino acids 544-644 of human AR-V7 (NP_001334990.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGEKFRVGNCKHLKMTRP | Uniprot ID | P10275-3 |
Uniprot Id
P10275
Target Species
Human
Target Name
AR
Target Full Name
Androgen receptor
Target Function
Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins like ZBTB7A that recruits NCOR1 and NCOR2 to the androgen response elements/ARE on target genes, negatively regulating androgen receptor signaling and androgen-induced cell proliferation. Transcription activation is also down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3.; Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.; Lacks the C-terminal ligand-binding domain and may therefore constitutively activate the transcription of a specific set of genes independently of steroid hormones.
Target Involvement
Androgen insensitivity syndrome (AIS); Spinal and bulbar muscular atrophy X-linked 1 (SMAX1); Androgen insensitivity, partial (PAIS)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Tissue Specificity
[Isoform 2]: Mainly expressed in heart and skeletal muscle.; [Isoform 3]: Expressed in basal and stromal cells of the prostate (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
AIS; ANDR_HUMAN; Androgen nuclear receptor variant 2; Androgen receptor (dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease); Androgen receptor; androgen receptor splice variant 4b; AR; AR8; DHTR; Dihydro testosterone receptor; Dihydrotestosterone receptor (DHTR); Dihydrotestosterone receptor; HUMARA; HYSP1; KD; Kennedy disease (KD); NR3C4; Nuclear receptor subfamily 3 group C member 4 (NR3C4); Nuclear receptor subfamily 3 group C member 4; SBMA; SMAX1; Spinal and bulbar muscular atrophy (SBMA); Spinal and bulbar muscular atrophy; Testicular Feminization (TFM); TFM
Target Background
The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract from the normal 9-34 repeats to the pathogenic 38-62 repeats causes spinal bulbar muscular atrophy (SBMA, also known as Kennedy's disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification