-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ARF4 (NP_001651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ARF4 (NP_001651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02394A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARF4 |
| Target Synonyms | ARF2; ARF4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ARF4 (NP_001651.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR | Uniprot ID | P18085 |
Uniprot Id
P18085
Target Species
Human
Target Name
ARF4
Target Full Name
ADP-ribosylation factor 4
Target Function
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Target Subcellular Location
Golgi apparatus. Membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Arf family
Target Research Area
Transport
Target Synonyms
ADP ribosylation factor 2 ; ADP ribosylation factor 4; ADP-ribosylation factor 4; ARF2; ARF4; ARF4_HUMAN
Target Background
This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene.
Notification