-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARF6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13767A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARF6 |
| Target Synonyms | ARF6; ADP-ribosylation factor 6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, Hep G2, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS | Uniprot ID | P62330 |
Uniprot Id
P62330
Target Species
Human
Target Name
ARF6
Target Full Name
ADP-ribosylation factor 6
Target Function
GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junction proteins such as CDH1. Required for NTRK1 sorting to the recycling pathway from early endosomes.; (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Target Subcellular Location
Cytoplasm, cytosol. Cell membrane; Lipid-anchor. Endosome membrane; Lipid-anchor. Recycling endosome membrane; Lipid-anchor. Cell projection, filopodium membrane; Lipid-anchor. Cell projection, ruffle. Cleavage furrow. Midbody, Midbody ring. Early endosome membrane; Lipid-anchor. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Arf family
Target Tissue Specificity
Ubiquitous, with higher levels in heart, substantia nigra, and kidney.
Target Research Area
Developmental Biology
Target Synonyms
ADP ribosylation factor 6 ; ADP ribosylation factor protein 6; ADP-ribosylation factor 6; ARF6; ARF6_HUMAN; DKFZp564M0264; Small GTP binding protein ; Small GTPase
Target Background
This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7.
Notification