Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGAP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ARHGAP4 (NP_001158213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ARHGAP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ARHGAP4 (NP_001158213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07252A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGAP4 |
| Target Synonyms | C1; RGC1; p115; SrGAP4; RhoGAP4; ARHGAP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ARHGAP4 (NP_001158213.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH | Uniprot ID | P98171 |
Uniprot Id
P98171
Target Species
Human
Target Name
ARHGAP4
Target Full Name
Rho GTPase-activating protein 4
Target Function
Inhibitory effect on stress fiber organization. May down-regulate Rho-like GTPase in hematopoietic cells.
Target Subcellular Location
Cytoplasm. Note=Just below the plasma membrane.
Target Tissue Specificity
Predominantly in hematopoietic cells (spleen, thymus and leukocytes); low levels in placenta, lung and various fetal tissues.
Target Synonyms
ARHGAP4; KIAA0131; RGC1; RHOGAP4; Rho GTPase-activating protein 4; Rho-GAP hematopoietic protein C1; Rho-type GTPase-activating protein 4; p115
Target Background
This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
