Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGEF10L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1120-1230 of human ARHGEF10L (NP_001011722) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ARHGEF10L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1120-1230 of human ARHGEF10L (NP_001011722) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07043A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGEF10L |
| Target Synonyms | GrinchGEF; ARHGEF10L | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1120-1230 of human ARHGEF10L (NP_001011722). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQAPCGETDST | Uniprot ID | Q9HCE6 |
Uniprot Id
Q9HCE6
Target Species
Human
Target Name
ARHGEF10L
Target Full Name
Rho guanine nucleotide exchange factor 10-like protein
Target Function
Acts as guanine nucleotide exchange factor (GEF) for RHOA, RHOB and RHOC.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Detected in heart, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
ARGAL_HUMAN; ARHGEF10L; GrinchGEF; KIAA1626; Rho guanine nucleotide exchange factor 10-like protein; RP11-473A10.1
Target Background
This gene belongs to the RhoGEF subfamily of RhoGTPases. Members of this subfamily are activated by specific guanine nucleotide exchange factors (GEFs) and are involved in signal transduction. The encoded protein shows cytosolic distribution. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
