Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ART5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-200 of human ART5 (NP_443750.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ART5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-200 of human ART5 (NP_443750.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02658A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ART5 |
| Target Synonyms | ARTC5; ART5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-200 of human ART5 (NP_443750.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLF | Uniprot ID | Q96L15 |
Uniprot Id
Q96L15
Target Species
Human
Target Name
ART5
Target Full Name
Ecto-ADP-ribosyltransferase 5
Target Subcellular Location
Secreted.
Target Protein Families
Arg-specific ADP-ribosyltransferase family
Target Synonyms
ADP ribosyltransferase 5; ADP-ribosyltransferase C2 and C3 toxin-like 5; ART 5; ART5; ARTC5; EC 2.4.2.31 ; Ecto ADP ribosyltransferase 5; Ecto-ADP-ribosyltransferase 5; MGC22848 ; Mono (ADP ribosyl) transferase 5; Mono(ADP-ribosyl)transferase 5; NAD(P)(+) arginine ADP ribosyltransferase 5; NAD(P)(+)--arginine ADP-ribosyltransferase 5; NAR5_HUMAN
Target Background
The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Several transcripts encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
