-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASCC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ASCC3 (NP_071374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ASCC3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ASCC3 (NP_071374.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01850A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASCC3 |
| Target Synonyms | RNAH; HELIC1; ASC1p200; ASCC3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Daudi | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ASCC3 (NP_071374.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEKSKMQSINEDLKDILHAAKQIEVNCPFQKRRLDGKEEDEKMSRASDRFRGLR | Uniprot ID | Q8N3C0 |
Uniprot Id
Q8N3C0
Target Species
Human
Target Name
ASCC3
Target Full Name
Activating signal cointegrator 1 complex subunit 3
Target Function
3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3, enabling ALKBH3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Also involved in activation of the ribosome quality control (RQC) pathway, a pathway that degrades nascent peptide chains during problematic translation. Drives the splitting of stalled ribosomes, as part of the ribosome quality control trigger (RQT) complex. Part of the ASC-1 complex that enhances NF-kappa-B, SRF and AP1 transactivation.
Target Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm, cytosol.
Target Protein Families
Helicase family
Target Tissue Specificity
Ubiquitous.
Target Research Area
others
Target Synonyms
Activating signal cointegrator 1 complex subunit 3; ASC-1 complex subunit p200; ASC-1 complex subunit p200-KD subunit; ASC1p200; ascc3; ATP binding 1; B630009I04Rik; dJ121G13.4; DJ467N11.1; HELC1_HUMAN; HELIC1; Helicase; helicase; ATP binding 1; p200; RNA helicase family; RNAH; RP1-121G13.4; Trip4 complex subunit p200
Target Background
This gene encodes a protein that belongs to a family of helicases that are involved in the ATP-dependent unwinding of nucleic acid duplexes. The encoded protein is the largest subunit of the activating signal cointegrator 1 complex that is involved in DNA repair and resistance to alkylation damage. Alternate splicing results in multiple transcript variants.
Notification