Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ASIC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-330 of human ASIC5 (NP_059115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ASIC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-330 of human ASIC5 (NP_059115.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01407A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ASIC5 |
| Target Synonyms | INAC; ACCN5; HINAC; ASIC5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-330 of human ASIC5 (NP_059115.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGC | Uniprot ID | Q9NY37 |
Uniprot Id
Q9NY37
Target Species
Human
Target Name
ASIC5
Target Full Name
Acid-sensing ion channel 5
Target Function
Cation channel that gives rise to very low constitutive currents in the absence of activation. The activated channel exhibits selectivity for sodium, and is inhibited by amiloride.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family, ASIC5 subfamily
Target Tissue Specificity
Detected in small intestine, duodenum and jejunum. Detected at very low levels in testis and rectum.
Target Synonyms
Acid-sensing ion channel 5; amiloride sensitive cation channel 5, intestinal; Amiloride sensitive sodium channel; Amiloride-sensitive cation channel 5; ASIC5; ASIC5_HUMAN; HINaC; Human intestine Na(+) channel; INAC
Target Background
This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
