Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ATE1 (NP_001001976.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ATE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ATE1 (NP_001001976.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14603A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATE1 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, A-549, HepG2, Mouse spleen, Rat skeletal muscle |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ATE1 (NP_001001976.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKF | Uniprot ID | O95260 |
Uniprot Id
O95260
Target Species
Human
Target Name
ATE1
Target Full Name
Arginyl-tRNA--protein transferase 1
Target Function
Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein. This arginylation is required for degradation of the protein via the ubiquitin pathway. Does not arginylate cysteine residues.
Target Subcellular Location
[Isoform ATE1-1]: Nucleus. Cytoplasm.; [Isoform ATE1-2]: Cytoplasm.
Target Protein Families
R-transferase family
Target Synonyms
AI225793; Arginine tRNA protein transferase 1; Arginine-tRNA--protein transferase 1; Arginyl-tRNA--protein transferase 1; Arginyl-tRNA-protein transferase; Arginyltransferase 1; Ate1; ATE1_HUMAN; AW547406; EC 2.3.2.8; MGC26724; OTTHUMP00000020637; OTTHUMP00000058665; R transferase 1; R-transferase 1
Target Background
This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
