-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATF6B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATF6B (Q99941) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATF6B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATF6B (Q99941) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04564A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATF6B |
| Target Synonyms | G13; CREBL1; CREB-RP; ATF6B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ATF6B (Q99941). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVS | Uniprot ID | Q99941 |
Uniprot Id
Q99941
Target Species
Human
Target Name
ATF6B
Target Full Name
Cyclic AMP-dependent transcription factor ATF-6 beta
Target Function
Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 beta), which is embedded in the endoplasmic reticulum membrane. Endoplasmic reticulum stress promotes processing of this form, releasing the transcription factor form that translocates into the nucleus, where it activates transcription of genes involved in the unfolded protein response (UPR).; Transcription factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN(9)CCAC[GA]-3') when NF-Y is bound to ERSE.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.; [Processed cyclic AMP-dependent transcription factor ATF-6 beta]: Nucleus.
Target Protein Families
BZIP family, ATF subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ATF6B; CREBL1; G13Cyclic AMP-dependent transcription factor ATF-6 beta; cAMP-dependent transcription factor ATF-6 beta; Activating transcription factor 6 beta; ATF6-beta; Protein G13; cAMP response element-binding protein-related protein; Creb-rp; cAMP-responsive element-binding protein-like 1) [Cleaved into: Processed cyclic AMP-dependent transcription factor ATF-6 beta]
Target Background
The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene.
Notification