Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ATG4C (NP_116241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATG4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ATG4C (NP_116241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02531A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG4C |
| Target Synonyms | APG4C; AUTL1; AUTL3; APG4-C; HsAPG4C; ATG4C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ATG4C (NP_116241.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKI | Uniprot ID | Q96DT6 |
Uniprot Id
Q96DT6
Target Species
Human
Target Name
ATG4C
Target Full Name
Cysteine protease ATG4C
Target Function
Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C54 family
Target Synonyms
APG4 autophagy 4 homolog C (S. cerevisiae); APG4 autophagy 4 homolog C; APG4 C; APG4-C; APG4C; ATG 4C; ATG4 autophagy related 4 homolog C (S. cerevisiae); ATG4 autophagy related 4 homolog C; Atg4c; ATG4C_HUMAN; AUT (S. cerevisiae) like 1; cysteine endopeptidase; AUT like 1; cysteine endopeptidase (S. cerevisiae); AUT like 1; cysteine endopeptidase; AUT like 3 cysteine endopeptidase; AUT-like 3 cysteine endopeptidase; AUTL1; AUTL3; Autophagin 3; Autophagin-3; Autophagy related 4C cysteine peptidase; Autophagy related cysteine endopeptidase 3; Autophagy related protein 4 homolog C; Autophagy-related cysteine endopeptidase 3; Autophagy-related protein 4 homolog C; Cysteine protease ATG4C; EC 3.4.22; FLJ14867; OTTHUMP00000010715
Target Background
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
