-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_001129503.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against ATG7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_001129503.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-09338A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATG7 |
| Target Synonyms | GSA7; APG7L; SCAR31; APG7-LIKE; ATG7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_001129503.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQVLDQYEREGFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI | Uniprot ID | O95352 |
Uniprot Id
O95352
Target Species
Human
Target Name
ATG7
Target Full Name
Ubiquitin-like modifier-activating enzyme ATG7
Target Function
E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes membranes. Required for autophagic death induced by caspase-8 inhibition. Required for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Modulates p53/TP53 activity to regulate cell cycle and survival during metabolic stress. Plays also a key role in the maintenance of axonal homeostasis, the prevention of axonal degeneration, the maintenance of hematopoietic stem cells, the formation of Paneth cell granules, as well as in adipose differentiation. Plays a role in regulating the liver clock and glucose metabolism by mediating the autophagic degradation of CRY1 (clock repressor) in a time-dependent manner.
Target Subcellular Location
Cytoplasm. Preautophagosomal structure.
Target Protein Families
ATG7 family
Target Tissue Specificity
Widely expressed, especially in kidney, liver, lymph nodes and bone marrow.
Target Synonyms
1810013K23Rik; Apg 7; APG7 autophagy 7 like; APG7 autophagy 7-like (S. cerevisiae); APG7 like; APG7; S. cerevisiae; homolog of; APG7-like; APG7L; ATG 7; ATG12-activating enzyme E1 ATG7; ATG7; ATG7 autophagy related 7 homolog (S. cerevisiae); ATG7 autophagy related 7 homolog; ATG7_HUMAN; Atg7l; Autophagy 7; S. cerevisiae; homolog of; Autophagy related protein 7; Autophagy-related 7 (yeast); Autophagy-related protein 7; DKFZp434N0735; GSA 7; GSA7; hAGP7; Ubiquitin activating enzyme E1 like protein; Ubiquitin-activating enzyme E1-like protein; Ubiquitin-like modifier-activating enzyme ATG7
Target Background
This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.
Notification