-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAG4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAG4 (NP_001191807.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BAG4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAG4 (NP_001191807.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04940A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAG4 |
| Target Synonyms | SODD; BAG-4; BAG4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAG4 (NP_001191807.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQSLNSYTNGAY | Uniprot ID | O95429 |
Uniprot Id
O95429
Target Species
Human
Target Name
BAG4
Target Full Name
BAG family molecular chaperone regulator 4
Target Function
Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. Prevents constitutive TNFRSF1A signaling. Negative regulator of PRKN translocation to damaged mitochondria.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
BAG 4; BAG family molecular chaperone regulator 4; BAG-4; BAG4; BAG4_HUMAN; Bcl 2 associated athanogene 4; Bcl-2-associated athanogene 4; BCL2 associated athanogene 4; Silencer of death domains; SODD
Target Background
The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified.
Notification