Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BATF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human BATF3 (NP_061134.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BATF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human BATF3 (NP_061134.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05381A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BATF3 |
| Target Synonyms | JDP1; SNFT; JUNDM1; BATF3 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-127 of human BATF3 (NP_061134.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR | Uniprot ID | Q9NR55 |
Uniprot Id
Q9NR55
Target Species
Human
Target Name
BATF3
Target Full Name
Basic leucine zipper transcriptional factor ATF-like 3
Target Function
AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family
Target Synonyms
BATF3; SNFTBasic leucine zipper transcriptional factor ATF-like 3; B-ATF-3; 21 kDa small nuclear factor isolated from T-cells; Jun dimerization protein p21SNFT
Target Background
This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
