-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BCAR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BCAR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00379A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BCAR1 |
| Target Synonyms | CAS; CAS1; CASS1; CRKAS; P130Cas; BCAR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATA | Uniprot ID | P56945 |
Uniprot Id
P56945
Target Species
Human
Target Name
BCAR1
Target Full Name
Breast cancer anti-estrogen resistance protein 1
Target Function
Docking protein which plays a central coordinating role for tyrosine kinase-based signaling related to cell adhesion. Implicated in induction of cell migration and cell branching. Involved in the BCAR3-mediated inhibition of TGFB signaling.
Target Subcellular Location
Cell junction, focal adhesion. Cytoplasm. Cell projection, axon.
Target Protein Families
CAS family
Target Tissue Specificity
Widely expressed with an abundant expression in the testis. Low level of expression seen in the liver, thymus, and peripheral blood leukocytes. The protein has been detected in a B-cell line.
Target Synonyms
BCAR 1; Bcar1; BCAR1_HUMAN; Breast cancer anti estrogen resistance 1; Breast cancer anti estrogen resistance 1 protein; Breast cancer anti-estrogen resistance protein 1; CAS; Cas scaffolding protein family member 1; CAS1; Cass1; Crk associated substrate; Crk associated substrate p130Cas; CRK-associated substrate; CRKAS; FLJ12176; FLJ45059; p130cas
Target Background
The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded protein contains a Src-homology 3 (SH3) domain, a proline-rich domain, a substrate domain which contains 15 repeat of the YxxP consensus phosphorylation motif for Src family kinases, a serine-rich domain, and a bipartite Src-binding domain, which can bind both SH2 and SH3 domains. This adaptor protein functions in multiple cellular pathways, including in cell motility, apoptosis and cell cycle control. Dysregulation of this gene can have a wide range of effects, affecting different pathways, including cardiac development, vascular smooth muscle cells, liver and kidney function, endothelial migration, and cancer.
Notification