Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BET1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BET1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03408A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BET1 |
| Target Synonyms | HBET1; BET1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQT | Uniprot ID | O15155 |
Uniprot Id
O15155
Target Species
Human
Target Name
BET1
Target Full Name
BET1 homolog
Target Function
Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus membrane.
Target Protein Families
BET1 family
Target Synonyms
BET1; BET1 homolog; hBET1; Golgi vesicular membrane-trafficking protein p18
Target Background
This gene encodes a golgi-associated membrane protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi complex. The encoded protein functions as a soluble N-ethylaleimide-sensitive factor attachment protein receptor and may be involved in the docking of ER-derived vesicles with the cis-Golgi membrane. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
