-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BMP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BMP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMP4 |
| Target Synonyms | ZYME; BMP2B; OFC11; BMP2B1; MCOPS6; BMP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549, Mouse large intestine, Mouse lung, Rat kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN | Uniprot ID | P12644 |
Uniprot Id
P12644
Target Species
Human
Target Name
BMP4
Target Full Name
Bone morphogenetic protein 4
Target Function
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt, or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response.
Target Involvement
Microphthalmia, syndromic, 6 (MCOPS6); Non-syndromic orofacial cleft 11 (OFC11)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
TGF-beta family
Target Tissue Specificity
Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.
Target Research Area
Developmental Biology
Target Synonyms
zgc:100779; BMP 2B; BMP 4; BMP-2B; BMP-4; BMP2B; BMP2B1; BMP4; BMP4_HUMAN; Bone morphogenetic protein 2B; Bone morphogenetic protein 4; DVR4; MCOPS6; MGC100779; OFC11; zbmp-4; ZYME
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Notification