-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7. (NP_037395.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BRD7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7. (NP_037395.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRD7 |
| Target Synonyms | BP75; NAG4; CELTIX1; SMARCI1; BRD7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain, Rat liver, U266 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7. (NP_037395.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD | Uniprot ID | Q9NPI1 |
Uniprot Id
Q9NPI1
Target Species
Human
Target Name
BRD7
Target Full Name
Bromodomain-containing protein 7
Target Function
Acts both as coactivator and as corepressor. May play a role in chromatin remodeling. Activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. Induces dephosphorylation of GSK3B at 'Tyr-216'. Down-regulates TRIM24-mediated activation of transcriptional activation by AR. Transcriptional corepressor that down-regulates the expression of target genes. Binds to target promoters, leading to increased histone H3 acetylation at 'Lys-9' (H3K9ac). Binds to the ESR1 promoter. Recruits BRCA1 and POU2F1 to the ESR1 promoter. Coactivator for TP53-mediated activation of transcription of a set of target genes. Required for TP53-mediated cell-cycle arrest in response to oncogene activation. Promotes acetylation of TP53 at 'Lys-382', and thereby promotes efficient recruitment of TP53 to target promoters. Inhibits cell cycle progression from G1 to S phase.
Target Subcellular Location
[Isoform 2]: Nucleus.
Target Synonyms
75 kDa bromodomain protein; BP75; BRD 7; BRD7; BRD7_HUMAN; Bromodomain containing 7; bromodomain containing protein 7; Bromodomain-containing protein 7; CELTIX 1; CELTIX1; NAG4; Protein CELTIX-1
Target Background
This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants.
Notification