Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C1QC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human C1QC (NP_001107573.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against C1QC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human C1QC (NP_001107573.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10875A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C1QC |
| Target Synonyms | C1QG; C1Q-C; C1QD3; C1QC | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human C1QC (NP_001107573.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGD | Uniprot ID | P02747 |
Uniprot Id
P02747
Target Species
Human
Target Name
C1QC
Target Full Name
Complement C1q subcomponent subunit C
Target Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Target Involvement
Complement component C1q deficiency (C1QD)
Target Subcellular Location
Secreted.
Target Synonyms
AI385742; C1Q C; C1qc; C1QC_HUMAN; C1QG; Complement C1q subcomponent subunit C; Complement component 1; q subcomponent; C chain; complement component 1; q subcomponent; gamma polypeptide
Target Background
This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
