Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-520 of human CACNB4 (NP_000717.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CACNB4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-520 of human CACNB4 (NP_000717.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08925A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNB4 |
| Target Synonyms | EA5; EJM; CAB4; EIG9; EJM4; EJM6; CACNLB4; CACNB4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 401-520 of human CACNB4 (NP_000717.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDSYQDTYKPHRNRGSPGGYSHDSRHRL | Uniprot ID | O00305 |
Uniprot Id
O00305
Target Species
Human
Target Name
CACNB4
Target Full Name
Voltage-dependent L-type calcium channel subunit beta-4
Target Function
The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Target Involvement
Epilepsy, idiopathic generalized 9 (EIG9); Juvenile myoclonic epilepsy 6 (EJM6); Episodic ataxia 5 (EA5)
Target Protein Families
Calcium channel beta subunit family
Target Tissue Specificity
Expressed predominantly in the cerebellum and kidney.
Target Synonyms
CAB4; CACB4_HUMAN; Cacnb4; CACNLB4; Calcium channel voltage dependent beta 4 subunit; Calcium channel voltage dependent subunit beta 4; Calcium channel voltage-dependent subunit beta 4; Dihydropyridine sensitive L type calcium channel beta 4 subunit; EA5; EIG9; EJM; EJM4; EJM6; Voltage-dependent L-type calcium channel subunit beta-4
Target Background
This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE), juvenile myoclonic epilepsy (JME), and episodic ataxia, type 5.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
