Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CaMKII was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CaMKII was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates using CaMKII Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-15634A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CaMKII |
| Target Synonyms | CAMKA; MRD53; MRT63; CaMKIIalpha; CaMKIINalpha; CaMKII | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Neuro-2a, U-87 MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMKII (NP_741960.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK | Uniprot ID | Q9UQM7, Q13554, Q13557, Q13555 |
Uniprot Id
Q9UQM7, Q13554, Q13557, Q13555
Target Synonyms
CAMKA; MRD53; MRT63; CaMKIIalpha; CaMKIINalpha; CaMKII
Target Background
The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Several transcript variants encoding distinct isoforms have been identified for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
