-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD301/CLEC10A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human CD301/CLEC10A (NP_878910.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD301/CLEC10A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human CD301/CLEC10A (NP_878910.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD301/CLEC10A |
| Target Synonyms | HML; MGL; HML2; CD301; CLECSF13; CLECSF14; CD301/CLEC10A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, HUVEC | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human CD301/CLEC10A (NP_878910.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTC | Uniprot ID | Q8IUN9 |
Uniprot Id
Q8IUN9
Target Species
Human
Target Name
CLEC10A
Target Full Name
C-type lectin domain family 10 member A
Target Function
Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Synonyms
C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 13 (macrophage derived); C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 14 (macrophage derived); C type lectin domain family 10; member A; C type lectin superfamily member 14; C-type lectin domain family 10 member A; C-type lectin superfamily member 14; CD301; CD301 antigen; CD301A; CLC10_HUMAN; CLEC10A; CLECSF13; CLECSF14; HML; HML2; Lectin; Macrophage C type lectin; MACROPHAGE GALACTOSE-TYPE C-TYPE; Macrophage lectin 2 (calcium dependent); Macrophage lectin 2; MGL; Mgl1
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene.
Notification