-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD3EAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human CD3EAP (NP_036231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD3EAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human CD3EAP (NP_036231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11348A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD3EAP |
| Target Synonyms | ASE1; CAST; ASE-1; PAF49; RPA34; CD3EAP | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human CD3EAP (NP_036231.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLL | Uniprot ID | O15446 |
Uniprot Id
O15446
Target Species
Human
Target Name
POLR1G
Target Full Name
DNA-directed RNA polymerase I subunit RPA34
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation.; Isoform 2 has been described as a component of preformed T-cell receptor (TCR) complex.
Target Subcellular Location
Nucleus, nucleolus. Chromosome. Note=Found at the fibrillar centers of the nucleolus in interphase and during cell division it is localized to the nucleolus organizer regions of the chromosomes.
Target Protein Families
Eukaryotic RPA34 RNA polymerase subunit family
Target Synonyms
A34.5; Anti sense to ERCC 1 protein; Antisense to ERCC-1 protein; ASE 1; ASE-1; ASE1; CAST; CD3 epsilon associated protein; CD3-epsilon-associated protein; CD3E antigen, epsilon polypeptide associated protein; CD3E associated protein; CD3e molecule, epsilon associated protein; CD3E-associated protein; CD3EAP; DNA directed RNA polymerase I subunit RPA34; DNA-directed RNA polymerase I subunit RPA34; MGC118851; PAF 49; PAF49; RNA polymerase I associated factor PAF49; RNA polymerase I-associated factor PAF49; RPA34_HUMAN
Target Background
Enables RNA binding activity. Predicted to be involved in transmembrane receptor protein tyrosine kinase signaling pathway. Predicted to act upstream of or within rRNA transcription. Located in cytosol; mitochondrion; and nuclear lumen.
Notification