-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD68 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD68 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13037A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD68 |
| Target Synonyms | GP110; LAMP4; SCARD1; CD68 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver, Rat lung, RAW264.7, THP-1, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK | Uniprot ID | P34810 |
Uniprot Id
P34810
Target Species
Human
Target Name
CD68
Target Full Name
Macrosialin
Target Function
Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.
Target Subcellular Location
[Isoform Short]: Cell membrane; Single-pass type I membrane protein.; [Isoform Long]: Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein.
Target Protein Families
LAMP family
Target Tissue Specificity
Highly expressed by blood monocytes and tissue macrophages. Also expressed in lymphocytes, fibroblasts and endothelial cells. Expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their diss
Target Synonyms
CD68; Macrosialin; Gp110; CD antigen CD68
Target Background
This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.
Notification