-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD70 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-193 of human CD70 (NP_001243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against CD70 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-193 of human CD70 (NP_001243.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-01417A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD70 |
| Target Synonyms | CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-193 of human CD70 (NP_001243.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP | Uniprot ID | P32970 |
Uniprot Id
P32970
Target Species
Human
Target Name
CD70
Target Full Name
CD70 antigen
Target Function
Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Research Area
Cancer
Target Synonyms
CD 27L; CD 70; CD27 L; CD27 LG; CD27 ligand; CD27-L; CD27L; CD27LG; CD70; CD70 antigen; CD70 molecule; CD70_HUMAN; Ki 24 antigen; Ki24 antigen; Surface antigen CD70; TNFSF 7 ; TNFSF7; Tumor necrosis factor (ligand) superfamily, member 7; Tumor necrosis factor ligand superfamily member 7
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Notification