Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD79B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD79B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04426A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD79B |
| Target Synonyms | B29; IGB; AGM6; Igbeta; CD79B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE | Uniprot ID | P40259 |
Uniprot Id
P40259
Target Species
Human
Target Name
CD79B
Target Full Name
B-cell antigen receptor complex-associated protein beta chain
Target Function
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Target Involvement
Agammaglobulinemia 6, autosomal recessive (AGM6)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
B-cells.
Target Synonyms
CD79B; B29; IGB; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b
Target Background
The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
