Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD83 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-143 of human CD83 (NP_004224.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD83 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-143 of human CD83 (NP_004224.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11317A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD83 |
| Target Synonyms | BL11; HB15; CD83 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse intestine | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-143 of human CD83 (NP_004224.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA | Uniprot ID | Q01151 |
Uniprot Id
Q01151
Target Species
Human
Target Name
CD83
Target Full Name
CD83 antigen
Target Function
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
Target Synonyms
CD83; CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Target Background
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
