-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD96 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human CD96 (NP_937839.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD96 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human CD96 (NP_937839.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07495A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD96 |
| Target Synonyms | TACTILE; CD96 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse spleen, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-370 of human CD96 (NP_937839.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIPVIVENNSTDVLVERRFTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSPVPGNKVWNIS | Uniprot ID | P40200 |
Uniprot Id
P40200
Target Species
Human
Target Name
CD96
Target Full Name
T-cell surface protein tactile
Target Function
May be involved in adhesive interactions of activated T and NK cells during the late phase of the immune response. Promotes NK cell-target adhesion by interacting with PVR present on target cells. May function at a time after T and NK cells have penetrated the endothelium using integrins and selectins, when they are actively engaging diseased cells and moving within areas of inflammation.
Target Involvement
C syndrome (CSYN)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed on normal T-cell lines and clones, and some transformed T-cells, but no other cultured cell lines tested. It is expressed at very low levels on activated B-cells.
Target Synonyms
CD96; T-cell surface protein tactile; Cell surface antigen CD96; T cell-activated increased late expression protein; CD antigen CD96
Target Background
The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing generates multiple transcript variants encoding distinct isoforms.
Notification