Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD99L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD99L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04752A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD99L2 |
| Target Synonyms | CD99B; MIC2L1; CD99L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse brain, Mouse liver, Mouse lung, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPG | Uniprot ID | Q8TCZ2 |
Uniprot Id
Q8TCZ2
Target Species
Human
Target Name
CD99L2
Target Full Name
CD99 antigen-like protein 2
Target Function
Plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Homophilic adhesion molecule, but these interactions may not be required for cell aggregation.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein; Extracellular side. Cell junction.
Target Protein Families
CD99 family
Target Tissue Specificity
Expressed in many tissues, with low expression in thymus.
Target Synonyms
C99L2_HUMAN; CD99; CD99 antigen-like protein 2; CD99L2; MIC2-like protein 1; MIC2L1
Target Background
This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
