-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC42 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-191 of human CDC42 (P60953) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDC42 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-191 of human CDC42 (P60953) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16714A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC42 |
| Target Synonyms | TKS; G25K; CDC42Hs; CDC42 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, HT-29, Mouse brain, Mouse liver, PC-3, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-191 of human CDC42 (P60953). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL | Uniprot ID | P60953 |
Uniprot Id
P60953
Target Species
Human
Target Name
CDC42
Target Full Name
Cell division control protein 42 homolog
Target Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase. Regulates cell migration. In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections. Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. Facilitates filopodia formation upon DOCK11-activation. Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling. Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups.
Target Involvement
Takenouchi-Kosaki syndrome (TKS)
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Midbody. Cell projection, dendrite.
Target Protein Families
Small GTPase superfamily, Rho family, CDC42 subfamily
Target Synonyms
CDC42; CDC42_HUMAN; CDC42Hs; Cell division control protein 42 homolog; Cell division cycle 42 (GTP binding protein 25kDa); Cell division cycle 42; dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein; 25kD)); dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein; 25kD)); G25K; G25K GTP-binding protein; Growth regulating protein; GTP binding protein 25kDa; Small GTP binding protein CDC42; TKS
Target Background
The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.
Notification