-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDK5R1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 195-295 of human CDK5R1 (NP_003876.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CDK5R1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 195-295 of human CDK5R1 (NP_003876.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15496A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDK5R1 |
| Target Synonyms | p23; p25; p35; CDK5R; NCK5A; CDK5P35; p35nck5a; CDK5R1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 195-295 of human CDK5R1 (NP_003876.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQ | Uniprot ID | Q15078 |
Uniprot Id
Q15078
Target Species
Human
Target Name
CDK5R1
Target Full Name
Cyclin-dependent kinase 5 activator 1
Target Function
p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.
Target Subcellular Location
[Cyclin-dependent kinase 5 activator 1, p35]: Cell membrane; Lipid-anchor; Cytoplasmic side. Cell projection, neuron projection.; [Cyclin-dependent kinase 5 activator 1, p25]: Nucleus. Cytoplasm, perinuclear region. Perikaryon.
Target Protein Families
Cyclin-dependent kinase 5 activator family
Target Tissue Specificity
Brain and neuron specific.
Target Research Area
Cell Biology
Target Synonyms
CD5R1_HUMAN; CDK5 activator 1; CDK5P35; CDK5R; CDK5R1; Cyclin dependent kinase 5 regulatory subunit 1; Cyclin-dependent kinase 5 activator 1; Cyclin-dependent kinase 5 regulatory subunit 1; NCK 5A; Neuronal CDK5 activator; p23; p25; p35; Regulatory partner for CDK5 kinase; Tau protein kinase II 23 kDa subunit; TPKII regulatory subunit
Target Background
The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.
Notification