Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDKN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CDKN3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04415A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDKN3 |
| Target Synonyms | KAP; CDI1; CIP2; KAP1; CDKN3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human CDKN3 (NP_005183.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKS | Uniprot ID | Q16667 |
Uniprot Id
Q16667
Target Species
Human
Target Name
CDKN3
Target Full Name
Cyclin-dependent kinase inhibitor 3
Target Function
May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
Target Involvement
Hepatocellular carcinoma (HCC)
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Protein-tyrosine phosphatase family
Target Research Area
Cell Biology
Target Synonyms
CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991
Target Background
The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
