-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CEP131 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1083 of human CEP131 (NP_001306157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CEP131 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1083 of human CEP131 (NP_001306157.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06996A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CEP131 |
| Target Synonyms | AZ1; ZA1; AZI1; CEP131 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1083 of human CEP131 (NP_001306157.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRQEFEDRLAASEEETRQAKAELATLQARQQLELEEVHRRVKTALARKEEAVSSLRTQHEAAVKRADHLEELLEQHRRPTPSTK | Uniprot ID | Q9UPN4 |
Uniprot Id
Q9UPN4
Target Species
Human
Target Name
CEP131
Target Full Name
Centrosomal protein of 131 kDa
Target Function
Component of centriolar satellites contributing to the building of a complex and dynamic network required to regulate cilia/flagellum formation. In proliferating cells, MIB1-mediated ubiquitination induces its sequestration within centriolar satellites, precluding untimely cilia formation initiation. In contrast, during normal and ultraviolet or heat shock cellular stress-induced ciliogenesis, its non-ubiquitinated form is rapidly displaced from centriolar satellites and recruited to centrosome/basal bodies in a microtubule- and p38 MAPK-dependent manner. Acts also as a negative regulator of BBSome ciliary trafficking. Plays a role in sperm flagellar formation; may be involved in the regulation of intraflagellar transport (IFT) and/or intramanchette (IMT) trafficking, which are important for axoneme extension and/or cargo delivery to the nascent sperm tail. Required for optimal cell proliferation and cell cycle progression; may play a role in the regulation of genome stability in non-ciliogenic cells. Involved in centriole duplication. Required for CEP152, WDR62 and CEP63 centrosomal localization and promotes the centrosomal localization of CDK2. Essential for maintaining proper centriolar satellite integrity.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Cytoplasmic vesicle, secretory vesicle, acrosome.
Target Protein Families
CEP131 family
Target Synonyms
5 azacytidine induced 1; 5-azacytidine-induced protein 1; AZ1; Azi; Azi1; AZI1_HUMAN; Centrosomal protein 131 kDa; Centrosomal protein of 131 kDa; Cep131; KIAA1118; OTTMUSP00000004498; Pre-acrosome localization protein 1; RP23 37J21.1
Target Background
Enables protein homodimerization activity. Involved in several processes, including intraciliary transport involved in cilium assembly; protein localization to centrosome; and regulation of centrosome duplication. Located in several cellular components, including ciliary transition zone; intercellular bridge; and microtubule organizing center. Colocalizes with centrosome.
Notification