-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CES2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CES2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06141A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CES2 |
| Target Synonyms | iCE; CE-2; PCE-2; CES2A1; CES2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse stomach, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 310-410 of human CES2 (NP_003860.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEM | Uniprot ID | O00748 |
Uniprot Id
O00748
Target Species
Human
Target Name
CES2
Target Full Name
Cocaine esterase
Target Function
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine. Hydrolyzes aspirin, substrates with large alcohol group and small acyl group and endogenous lipids such as triacylglycerol. Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes of 2-arachidonoylglycerol and prostaglandins.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum.
Target Research Area
Metabolism
Target Synonyms
Carboxylesterase 2 (intestine; liver); Carboxylesterase 2; CE-2; CES2; CES2A1; Cocaine esterase; EC 3.1.1.1; EST2_HUMAN; hCE-2; ICE; Iintestinal carboxylesterase liver carboxylesterase 2; Intestinal carboxylesterase; liver carboxylesterase-2; Methylumbelliferyl acetate deacetylase 2; PCE 2; PCE-2
Target Background
This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.
Notification