Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CFAP20/GTL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CFAP20/GTL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15675A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CFAP20/GTL3 |
| Target Synonyms | GTL3; BUG22; EVORF; fSAP23; C16orf80; CFAP20/GTL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ | Uniprot ID | Q9Y6A4 |
Uniprot Id
Q9Y6A4
Target Species
Human
Target Name
CFAP20
Target Full Name
Cilia- and flagella-associated protein 20
Target Function
Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Cell projection, cilium.
Target Protein Families
CFAP20 family
Target Research Area
others
Target Synonyms
CFAP20; BUG22; C16orf80; GTL3; Cilia- and flagella-associated protein 20; Basal body up-regulated protein 22; Transcription factor IIB
Target Background
Enables RNA binding activity. Involved in several processes, including positive regulation of feeding behavior; protein polyglutamylation; and regulation of cell motility. Located in centriole; ciliary basal body; and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
