-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human CHP1 (NP_009167.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CHP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human CHP1 (NP_009167.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04834A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHP1 |
| Target Synonyms | CHP; p22; p24; SPAX9; Sid470p; SLC9A1BP; CHP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Rat brain, 293T, LO2, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human CHP1 (NP_009167.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH | Uniprot ID | Q99653 |
Uniprot Id
Q99653
Target Species
Human
Target Name
CHP1
Target Full Name
Calcineurin B homologous protein 1
Target Function
Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum- and GTPase-stimulated Na(+)/H(+) exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate-phosphorylations in a calcium-dependent manner.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Endomembrane system. Endoplasmic reticulum-Golgi intermediate compartment. Endoplasmic reticulum. Cell membrane. Membrane; Lipid-anchor.
Target Protein Families
Calcineurin regulatory subunit family, CHP subfamily
Target Tissue Specificity
Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen.
Target Synonyms
Calcineurin B homolog; Calcineurin B homologous protein; Calcineurin homologous protein; Calcineurin like EF hand protein 1; Calcium binding protein CHP; Calcium binding protein p22; Calcium-binding protein CHP; Calcium-binding protein p22; chp; CHP1_HUMAN; Sid 470; Sid470; SLC9A1 binding protein; SLC9A1BP; Wrch2
Target Background
This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity.
Notification