-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDN8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-81 of human CLDN8 (NP_955360.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLDN8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-81 of human CLDN8 (NP_955360.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10947A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDN8 |
| Target Synonyms | HEL-S-79; CLDN8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Mouse pancreas, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-81 of human CLDN8 (NP_955360.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAAR | Uniprot ID | P56748 |
Uniprot Id
P56748
Target Species
Human
Target Name
CLDN8
Target Full Name
Claudin-8
Target Function
Tight-junction protein required for paracellular chloride transport in the kidney. Mediates recruitment of CLDN4 to tight junction in the kidney. Claudins play a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Claudin family
Target Tissue Specificity
Expressed in the epididymis, mainly in the caput segment.
Target Synonyms
CLDN8; UNQ779/PRO1573; Claudin-8
Target Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an immunohistochemical marker for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.
Notification