-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-188 of human CLEC5A (NP_037384.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLEC5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-188 of human CLEC5A (NP_037384.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09842A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC5A |
| Target Synonyms | MDL1; MDL-1; CLECSF5; CLEC5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, LO2, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-188 of human CLEC5A (NP_037384.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK | Uniprot ID | Q9NY25 |
Uniprot Id
Q9NY25
Target Species
Human
Target Name
CLEC5A
Target Full Name
C-type lectin domain family 5 member A
Target Function
Functions as a positive regulator of osteoclastogenesis. Cell surface receptor that signals via TYROBP. Regulates inflammatory responses.; (Microbial infection) Critical macrophage receptor for dengue virus serotypes 1-4. The binding of dengue virus to CLEC5A triggers signaling through the phosphorylation of TYROBP. This interaction does not result in viral entry, but stimulates proinflammatory cytokine release.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Highly expressed in bone marrow with lower levels in synovium, lung and bronchus. Expressed in peripheral blood monocytes and in the monocyte/macrophage cell lines U-937 and Mono-Mac-6, but not in cell lines of other origins. Expression is down-regulated
Target Synonyms
C type lectin domain family 5 member A; C-type lectin domain family 5 member A; C-type lectin superfamily member 5; CLC5A_HUMAN; CLEC5 A; CLEC5A; CLECSF 5; CLECSF5; MDL 1; MDL-1; MDL1; Myeloid DAP12 associating lectin; Myeloid DAP12-associating lectin 1
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined.
Notification